Structure of PDB 6ko2 Chain A Binding Site BS01

Receptor Information
>6ko2 Chain A (length=107) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SEQLKCCSGILKEMFAKKHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDM
STIKSKLEAREYRDAQEFGADVRLMFSNCYKYNPPDHEVVAMARKLQDVF
EMRFAKM
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ko2 Crystal Structure of BRD4-Bromo2 in complex with H2A.ZK4acK7ac peptide
Resolution1.5 Å
Binding residue
(original residue number in PDB)
W374 P375 G386 Y432 N433 H437 E438
Binding residue
(residue number reindexed from 1)
W24 P25 G36 Y82 N83 H87 E88
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6ko2, PDBe:6ko2, PDBj:6ko2
PDBsum6ko2
PubMed
UniProtO60885|BRD4_HUMAN Bromodomain-containing protein 4 (Gene Name=BRD4)

[Back to BioLiP]