Structure of PDB 6knw Chain A Binding Site BS01

Receptor Information
>6knw Chain A (length=243) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KPEPTDEEWELIKTVTEAHVATNAQGSHWKQKRKFLPEDIGQAPIKVDLE
AFSHFTKIITPAITRVVDFAKKLPMFCELPCEDQIILLKGCCMEIMSLRA
AVRYDPESETLTLNGEMAVTRGQLKNGGLGVVSDAIFDLGMSLSSFNLDD
TEVALLQAVLLMSSDRPGLACVERIEKYQDSFLLAFEHYINYRKHHVTHF
WPKLLMKVTDLRMIGACHASHFLHMKVECPTELFPPLFLEVFE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6knw Revealing a Mutant-Induced Receptor Allosteric Mechanism for the Thyroid Hormone Resistance.
Resolution2.67 Å
Binding residue
(original residue number in PDB)		K288 E299 I302 L454 E457
Binding residue
(residue number reindexed from 1)		K71 E82 I85 L237 E240
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0004879 nuclear receptor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6knw, PDBe:6knw, PDBj:6knw
PDBsum6knw
PubMed31655060
UniProtP10828|THB_HUMAN Thyroid hormone receptor beta (Gene Name=THRB)

[Back to BioLiP]