Structure of PDB 6kmj Chain A Binding Site BS01

Receptor Information
>6kmj Chain A (length=112) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SLGIFPTVEKLVEEMREQLDEVDSHPRTSIFEKLPSKRDYPDYFKVIEKP
MAIDIILKNCKNGTYKTLEEVRQALQTMFENARFYNEEGSWVYVDADKLN
EFTDEWFKEHSS
Ligand information
>6kmj Chain C (length=17) Species: 559292 (Saccharomyces cerevisiae S288C) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
TARKSTGGKAPRKQLAY
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6kmj The Structural Basis for Specific Recognition of H3K14 Acetylation by Sth1 in the RSC Chromatin Remodeling Complex.
Resolution1.4 Å
Binding residue
(original residue number in PDB)		D1267 D1270 H1272 Y1287 F1331 Y1332 N1333 E1334 S1337 W1338
Binding residue
(residue number reindexed from 1)		D20 D23 H25 Y40 F84 Y85 N86 E87 S90 W91
Enzymatic activity
Enzyme Commision number 3.6.4.12: DNA helicase.
Gene Ontology
Biological Process
GO:0006338 chromatin remodeling
Cellular Component
GO:0016586 RSC-type complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6kmj, PDBe:6kmj, PDBj:6kmj
PDBsum6kmj
PubMed31711754
UniProtP32597|STH1_YEAST Nuclear protein STH1/NPS1 (Gene Name=STH1)

[Back to BioLiP]