Structure of PDB 6klr Chain A Binding Site BS01

Receptor Information
>6klr Chain A (length=297) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GLLYAGFNQDHGCFACGMENGFRVYNTDPLKEKEKQEFLEGGVGHVEMLF
RCNYLALVGGGKKKVMIWDDLKKKTVIEIEFSTEVKAVKLRRDRIVVVLD
SMIKVFTFTHNPHQLHVFETCYNPKGLCVLCPNSNNSLLAFPGTHTGHVQ
LVDLASTEKPPVDIPAHEGVLSCIALNLQGTRIATASEKGTLIRIFDTSS
GHLIQELRRGSQAANIYCINFNQDASLICVSSDHGTVHIFAAEDPKSKWS
FSKFQCICAFGTEPNAVIAICADGSYYKFLFNPKGECIRDVYAQFLE
Ligand information
>6klr Chain B (length=22) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
EPVVTQLHPGPIVVRDGYFSRP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6klr Multi-site-mediated entwining of the linear WIR-motif around WIPI beta-propellers for autophagy.
Resolution2.21 Å
Binding residue
(original residue number in PDB)		N34 K39 K41 R59 C60 N61 Y62 D78 K82 T83 V84 E86 I87 E88 F89 R100 K112 H118 N119 P120
Binding residue
(residue number reindexed from 1)		N26 K31 K33 R51 C52 N53 Y54 D70 K74 T75 V76 E78 I79 E80 F81 R92 K104 H110 N111 P112
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0008289 lipid binding
GO:0032266 phosphatidylinositol-3-phosphate binding
GO:0062078 TSC1-TSC2 complex binding
GO:0080025 phosphatidylinositol-3,5-bisphosphate binding
Biological Process
GO:0000045 autophagosome assembly
GO:0000422 autophagy of mitochondrion
GO:0006914 autophagy
GO:0009267 cellular response to starvation
GO:0034497 protein localization to phagophore assembly site
GO:0044804 nucleophagy
GO:0061723 glycophagy
Cellular Component
GO:0000407 phagophore assembly site
GO:0005764 lysosome
GO:0005829 cytosol
GO:0019898 extrinsic component of membrane
GO:0034045 phagophore assembly site membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6klr, PDBe:6klr, PDBj:6klr
PDBsum6klr
PubMed32483132
UniProtQ2TAZ0;
Q5MNZ6

[Back to BioLiP]