Structure of PDB 6kkg Chain A Binding Site BS01

Receptor Information
>6kkg Chain A (length=87) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DPLPDNWEMAYTEKGEVYFIDHNTKTTSWLDPRLAKKAKPPEECKENELP
YGWEKIDDPIYGTYYVDHINRRTQFENPVLEAKRKLQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6kkg Phase separation of MAGI2-mediated complex underlies formation of slit diaphragm complex in glomerular filtration barrier
Resolution2.15 Å
Binding residue
(original residue number in PDB)
E308 A310 Y311 Y318 I320 H322 K325 T327 S328 W329 V366 H368 R371 T373 Q374 F375
Binding residue
(residue number reindexed from 1)
E8 A10 Y11 Y18 I20 H22 K25 T27 S28 W29 V66 H68 R71 T73 Q74 F75
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6kkg, PDBe:6kkg, PDBj:6kkg
PDBsum6kkg
PubMed
UniProtQ9WVQ1|MAGI2_MOUSE Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2 (Gene Name=Magi2)

[Back to BioLiP]