Structure of PDB 6ki6 Chain A Binding Site BS01

Receptor Information
>6ki6 Chain A (length=81) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RSDTCEYCGKVFKNCSNLTVHRRSHTGERPYKCELCNYACAQSSKLTRHM
KTHGDVYKCEICKMPFSVYSTLEKHMKKWHS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ki6 Structural insights into the recognition of gamma-globin gene promoter by BCL11A.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		K749 N756 Y777 Q781 K784 R787 H788 T814
Binding residue
(residue number reindexed from 1)		K10 N17 Y38 Q42 K45 R48 H49 T71
Binding affinityPDBbind-CN: Kd=72nM
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6ki6, PDBe:6ki6, PDBj:6ki6
PDBsum6ki6
PubMed31467406
UniProtQ9H165|BC11A_HUMAN B-cell lymphoma/leukemia 11A (Gene Name=BCL11A)

[Back to BioLiP]