Structure of PDB 6key Chain A Binding Site BS01

Receptor Information

>6key Chain A (length=200) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GDLSCPEGLEELLSAPPPDLGAQRRHGWNPKDCSENIEVKEGGLYFERRP
VAQSTDGARGKRGYSRGLHAWEISWPLEQRGTHAVVGVATALAPLQTDHY
AALLGSNSESWGWDIGRGKLYHQSKGPGAPQYPAGTQGEQLEVPERLLVV
LDMEEGTLGYAIGGTYLGPAFRGLKGRTLYPAVSAVWGQCQVRIRYLGER

Ligand information

>6key Chain B (length=8) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

KDINNNVE

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6key Structural basis for the regulation of inducible nitric oxide synthase by the SPRY domain-containing SOCS box protein SPSB2, an E3 ubiquitin ligase.
Resolution	1.24 Å
Binding residue (original residue number in PDB)	R68 P70 V71 A72 G101 T102 Y120 V206 W207 G208
Binding residue (residue number reindexed from 1)	R48 P50 V51 A52 G81 T82 Y100 V186 W187 G188

Enzymatic activity

Enzyme Commision number

External links

PDB	RCSB:6key, PDBe:6key, PDBj:6key
PDBsum	6key
PubMed	33862200
UniProt	Q99619\|SPSB2_HUMAN SPRY domain-containing SOCS box protein 2 (Gene Name=SPSB2)

[Back to BioLiP]