Structure of PDB 6kc4 Chain A Binding Site BS01

Receptor Information

>6kc4 Chain A (length=101) Species: 9606 (Homo sapiens)

SKPLAEQDWYHGAIPRIEAQELLKKQGDFLVRESHGKPGEYVLSVYSDGQ
RRHFIIQYVDNMYRFEGTGFSNIPQLIDHHYTTKQVITKKSGVVLLNPIP
K

Ligand information

>6kc4 Chain B (length=6) Species: 32630 (synthetic construct)

DEYENV

Receptor-Ligand Complex Structure

Structure summary

• PDB: 6kc4 High-resolution structural analysis shows how different crystallographic environments can induce alternative modes of binding of a phosphotyrosine peptide to the SH2 domain of Fer tyrosine kinase.
• Resolution: 1.37 Å
• Binding residue (original residue number in PDB): R467 R483 S485 H486 G487 K488 V493 R503 H504 F505 I506
• Binding residue (residue number reindexed from 1): R16 R32 S34 H35 G36 K37 V42 R52 H53 F54 I55

Enzymatic activity

• Enzyme Commision number: 2.7.10.2: non-specific protein-tyrosine kinase.

External links

• PDB: RCSB:6kc4, PDBe:6kc4, PDBj:6kc4
• PDBsum: 6kc4
• PubMed: 31441171
• UniProt: P16591|FER_HUMAN Tyrosine-protein kinase Fer (Gene Name=FER)