Structure of PDB 6kbn Chain A Binding Site BS01

Receptor Information
>6kbn Chain A (length=498) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPLKALTTLVYSDNLNLQRSAALAFAEITEKYVRQVSREVLEPILILLQS
QDPQIQVAACAALGNLAVNNENKLLIVEMGGLEPLINQMMGDNVEVQCNA
VGCITNLATRDDNKHKIATSGALIPLTKLAKSKHIRVQRNATGALLNMTH
SEENRKELVNAGAVPVLVSLLSSTDPDVQYYCTTALSNIAVDEANRKKLA
QTEPRLVSKLVSLMDSPSSRVKCQATLALRNLASDTSYQLEIVRAGGLPH
LVKLIQSDSIPLVLASVACIRNISIHPLNEGLIVDAGFLKPLVRLLDYKD
SEEIQCHAVSTLRNLAASSEKNRKEFFESGAVEKCKELALDSPVSVQSEI
SACFAILALADVSKLDLLEANILDALIPMTFSQNQEVSGNAAAALANLCS
RVNNYTKIIEAWDRPNEGIRGFLIRFLKSDYATFEHIALWTILQLLESHN
DKVEDLVKNDDDIINGVRKMADVTFERLQRSGDASLELYNITQQILQF
Ligand information
>6kbn Chain B (length=21) Species: 4932 (Saccharomyces cerevisiae) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
RQPYHYSQPTTAPFQAQAKFH
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6kbn Quaternary structures of Vac8 differentially regulate the Cvt and PMN pathways.
Resolution3.2 Å
Binding residue
(original residue number in PDB)		G110 N111 V114 N145 G148 N152 N186 L192 N193 Y226 Y227 N234 V237 R276 N277 R317 E348 E349 C352 H353 S391 S394 E395 N436
Binding residue
(residue number reindexed from 1)		G64 N65 V68 N99 G102 N106 N140 L146 N147 Y180 Y181 N188 V191 R230 N231 R271 E302 E303 C306 H307 S345 S348 E349 N390
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0042802 identical protein binding
GO:0043495 protein-membrane adaptor activity
Biological Process
GO:0000011 vacuole inheritance
GO:0000045 autophagosome assembly
GO:0000425 pexophagy
GO:0006629 lipid metabolic process
GO:0006914 autophagy
GO:0016236 macroautophagy
GO:0031503 protein-containing complex localization
GO:0034497 protein localization to phagophore assembly site
GO:0034517 ribophagy
GO:0034727 piecemeal microautophagy of the nucleus
GO:0042144 vacuole fusion, non-autophagic
GO:0051656 establishment of organelle localization
GO:0071255 Cvt vesicle assembly
GO:0071562 nucleus-vacuole junction assembly
GO:1903044 protein localization to membrane raft
Cellular Component
GO:0000329 fungal-type vacuole membrane
GO:0000407 phagophore assembly site
GO:0005640 nuclear outer membrane
GO:0005773 vacuole
GO:0005774 vacuolar membrane
GO:0005829 cytosol
GO:0016020 membrane
GO:0031965 nuclear membrane
GO:0045121 membrane raft
GO:0071561 nucleus-vacuole junction
GO:0071563 Myo2p-Vac17p-Vac8p transport complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6kbn, PDBe:6kbn, PDBj:6kbn
PDBsum6kbn
PubMed31512555
UniProtP39968|VAC8_YEAST Vacuolar protein 8 (Gene Name=VAC8)

[Back to BioLiP]