Structure of PDB 6k81 Chain A Binding Site BS01

Receptor Information
>6k81 Chain A (length=245) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FFVNRGGLPVDEATWERMWKHVAKIHPDGEKVAQRIRGATDLPKIPIPSV
PTFQPSTPVPERLEAVQRYIRELQYNHTGTQFFEIKKSRPLTGLMDLAKE
MTKEALPIKCLEAVILGIYLTNSMPTLERFPISFKTYFSGNYFRHIVLGV
NFAGRYGALGMSRREDLMYKPPAFRTLSELVLDFEAAYGRCWHVLKKVKL
GQSVSHDPHSVEQIEWKHSVLDVERLGRDDFRKELERHARDMRLK
Ligand information
>6k81 Chain B (length=29) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
KSAQQELKQRQRAEIYALNRVMTELEQQQ
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6k81 Structural insights into tubulin detyrosination by vasohibins-SVBP complex.
Resolution2.28 Å
Binding residue
(original residue number in PDB)		P68 V69 W74 V81 H85 I95 R96 G97 L101 I104 P105 L132 Q133 Y134 H136 F141 E163 A164 L165 P166
Binding residue
(residue number reindexed from 1)		P9 V10 W15 V22 H26 I36 R37 G38 L42 I45 P46 L73 Q74 Y75 H77 F82 E104 A105 L106 P107
Enzymatic activity
Enzyme Commision number 3.4.17.17: tubulinyl-Tyr carboxypeptidase.
Gene Ontology
Molecular Function
GO:0003779 actin binding
GO:0004180 carboxypeptidase activity
GO:0004181 metallocarboxypeptidase activity
GO:0005515 protein binding
GO:0106423 tubulin-tyrosine carboxypeptidase
Biological Process
GO:0001525 angiogenesis
GO:0001937 negative regulation of endothelial cell proliferation
GO:0006508 proteolysis
GO:0009611 response to wounding
GO:0016525 negative regulation of angiogenesis
GO:0043537 negative regulation of blood vessel endothelial cell migration
GO:0045765 regulation of angiogenesis
GO:0051726 regulation of cell cycle
GO:0060674 placenta blood vessel development
GO:0060716 labyrinthine layer blood vessel development
GO:1901491 negative regulation of lymphangiogenesis
GO:2000772 regulation of cellular senescence
Cellular Component
GO:0005576 extracellular region
GO:0005615 extracellular space
GO:0005737 cytoplasm
GO:0005783 endoplasmic reticulum
GO:0045177 apical part of cell

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6k81, PDBe:6k81, PDBj:6k81
PDBsum6k81
PubMed31908845
UniProtQ7L8A9|VASH1_HUMAN Tubulinyl-Tyr carboxypeptidase 1 (Gene Name=VASH1)

[Back to BioLiP]