Structure of PDB 6k5t Chain A Binding Site BS01

Receptor Information
>6k5t Chain A (length=77) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
YIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQR
IADNHTPKELGMEEEDVIEVYQEQTGG
Ligand information
>6k5t Chain B (length=12) Species: 10360 (Human herpesvirus 5 strain AD169) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
DTAGCIVISDSE
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6k5t Casein kinase-2-mediated phosphorylation increases the SUMO-dependent activity of the cytomegalovirus transactivator IE2.
ResolutionN/A
Binding residue
(original residue number in PDB)		E33 I34 H35 F36 K37 K39 T41 T42 H43 K46
Binding residue
(residue number reindexed from 1)		E13 I14 H15 F16 K17 K19 T21 T22 H23 K26
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6k5t, PDBe:6k5t, PDBj:6k5t
PDBsum6k5t
PubMed31371453
UniProtP63165|SUMO1_HUMAN Small ubiquitin-related modifier 1 (Gene Name=SUMO1)

[Back to BioLiP]