Structure of PDB 6jzn Chain A Binding Site BS01

Receptor Information
>6jzn Chain A (length=130) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KRPMDTEEAEELVRQWENVKAEALGPTHQVYSLSEVLDESMLVQWQTLAQ
TAEAKSCYWRFVLLHLEVLQAHIFEDGEAAEIEALLEEAAELVDESQPKN
AKYYSTYKIRYILKKQEDGLWKFCQSDIQI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6jzn Structure of PARC6 and PDV1 complex from Arabidopsis thaliana
Resolution2.894 Å
Binding residue
(original residue number in PDB)
W700 E701 K704 W729 K739 W743 F745 L779 A788 Y790 S792 Y794 I796 Y798
Binding residue
(residue number reindexed from 1)
W16 E17 K20 W45 K55 W59 F61 L92 A101 Y103 S105 Y107 I109 Y111
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6jzn, PDBe:6jzn, PDBj:6jzn
PDBsum6jzn
PubMed
UniProtQ8VY16|CDP1_ARATH Plastid division protein CDP1, chloroplastic (Gene Name=CDP1)

[Back to BioLiP]