Structure of PDB 6jzd Chain A Binding Site BS01

Receptor Information

>6jzd Chain A (length=251) Species: 10090 (Mus musculus)

FHVNKSGFPIDSHTWERMWLHVAKVHPRGGEMVGAIRNAAFLAKPSIPQV
PNYRLSMTIPDWLQAIQNYMKTLQYNHTGTQFFEIRKMRPLSGLMETAKE
MTRESLPIKALEAVILGIYLTNGQPSIERFPISFKTYFSGNYFHHVVLGI
YCNGYYGSLGMSRRAELMDKPLTFRTLSDLVFDFEDSYKKYLHTVKKVKI
GLYVPHEPHSFQPIEWKQLVLNVSKMLRADIRKELEKYARDMRMKILKPA
S

Ligand information

>6jzd Chain C (length=5) Species: 10090 (Mus musculus)

EGEEY

Receptor-Ligand Complex Structure

Structure summary

• PDB: 6jzd Structural basis of tubulin detyrosination by VASH2/SVBP heterodimer.
• Resolution: 2.479 Å
• Binding residue (original residue number in PDB): Y123 K157 A158 F186 F191 H193 R211 Y239 H241
• Binding residue (residue number reindexed from 1): Y75 K109 A110 F138 F143 H145 R163 Y191 H193

Enzymatic activity

• Enzyme Commision number: 3.4.17.17: tubulinyl-Tyr carboxypeptidase.

Gene Ontology

Molecular Function

• GO:0003779 actin binding
• GO:0004180 carboxypeptidase activity
• GO:0004181 metallocarboxypeptidase activity
• GO:0005515 protein binding
• GO:0008017 microtubule binding
• GO:0106423 tubulin-tyrosine carboxypeptidase

Biological Process

• GO:0000768 syncytium formation by plasma membrane fusion
• GO:0001938 positive regulation of endothelial cell proliferation
• GO:0006508 proteolysis
• GO:0045765 regulation of angiogenesis
• GO:0045766 positive regulation of angiogenesis
• GO:0060674 placenta blood vessel development
• GO:0060711 labyrinthine layer development
• GO:0060716 labyrinthine layer blood vessel development
• GO:0061564 axon development
• GO:0140253 cell-cell fusion

Cellular Component

• GO:0005576 extracellular region
• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005856 cytoskeleton

External links

• PDB: RCSB:6jzd, PDBe:6jzd, PDBj:6jzd
• PDBsum: 6jzd
• PubMed: 31324789
• UniProt: Q8C5G2|VASH2_MOUSE Tubulinyl-Tyr carboxypeptidase 2 (Gene Name=Vash2)