Structure of PDB 6jxw Chain A Binding Site BS01

Receptor Information
>6jxw Chain A (length=77) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQ
PINETDTPAQLEMEDEDTIDVFQQQTG
Ligand information
>6jxw Chain B (length=12) Species: 10298 (Human alphaherpesvirus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
NNRDPIVISDSP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6jxw The Viral SUMO-Targeted Ubiquitin Ligase ICP0 is Phosphorylated and Activated by Host Kinase Chk2.
ResolutionN/A
Binding residue
(original residue number in PDB)		G27 V29 V30 Q31 F32 K33 I34 K42 R50
Binding residue
(residue number reindexed from 1)		G12 V14 V15 Q16 F17 K18 I19 K27 R35
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0031386 protein tag activity
GO:0031625 ubiquitin protein ligase binding
GO:0044389 ubiquitin-like protein ligase binding
Biological Process
GO:0016925 protein sumoylation
GO:0032436 positive regulation of proteasomal ubiquitin-dependent protein catabolic process
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0016605 PML body

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6jxw, PDBe:6jxw, PDBj:6jxw
PDBsum6jxw
PubMed32001251
UniProtP61956|SUMO2_HUMAN Small ubiquitin-related modifier 2 (Gene Name=SUMO2)

[Back to BioLiP]