Structure of PDB 6jxu Chain A Binding Site BS01

Receptor Information
>6jxu Chain A (length=77) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
YIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQR
IADNHTPKELGMEEEDVIEVYQEQTGG
Ligand information
>6jxu Chain B (length=12) Species: 10298 (Human alphaherpesvirus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
NNRDPIVISDSP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6jxu The Viral SUMO-Targeted Ubiquitin Ligase ICP0 is Phosphorylated and Activated by Host Kinase Chk2.
ResolutionN/A
Binding residue
(original residue number in PDB)		S31 S32 E33 H35 F36 K37 T42 L47 R54
Binding residue
(residue number reindexed from 1)		S11 S12 E13 H15 F16 K17 T22 L27 R34
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0008134 transcription factor binding
GO:0015459 potassium channel regulator activity
GO:0019899 enzyme binding
GO:0031386 protein tag activity
GO:0031625 ubiquitin protein ligase binding
GO:0044388 small protein activating enzyme binding
GO:0044389 ubiquitin-like protein ligase binding
GO:1990381 ubiquitin-specific protease binding
Biological Process
GO:0006281 DNA repair
GO:0006355 regulation of DNA-templated transcription
GO:0010621 negative regulation of transcription by transcription factor localization
GO:0016925 protein sumoylation
GO:0030578 PML body organization
GO:0031334 positive regulation of protein-containing complex assembly
GO:0031647 regulation of protein stability
GO:0032436 positive regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:0032880 regulation of protein localization
GO:0034605 cellular response to heat
GO:0042308 negative regulation of protein import into nucleus
GO:0043392 negative regulation of DNA binding
GO:0043433 negative regulation of DNA-binding transcription factor activity
GO:0045759 negative regulation of action potential
GO:0045892 negative regulation of DNA-templated transcription
GO:0050821 protein stabilization
GO:0060021 roof of mouth development
GO:0071276 cellular response to cadmium ion
GO:0086004 regulation of cardiac muscle cell contraction
GO:0090204 protein localization to nuclear pore
GO:1901896 positive regulation of ATPase-coupled calcium transmembrane transporter activity
GO:1902260 negative regulation of delayed rectifier potassium channel activity
GO:1903169 regulation of calcium ion transmembrane transport
Cellular Component
GO:0001741 XY body
GO:0005634 nucleus
GO:0005643 nuclear pore
GO:0005654 nucleoplasm
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0008076 voltage-gated potassium channel complex
GO:0016604 nuclear body
GO:0016605 PML body
GO:0016607 nuclear speck
GO:0031965 nuclear membrane
GO:0097165 nuclear stress granule
GO:0098978 glutamatergic synapse
GO:0099523 presynaptic cytosol
GO:0099524 postsynaptic cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6jxu, PDBe:6jxu, PDBj:6jxu
PDBsum6jxu
PubMed32001251
UniProtP63165|SUMO1_HUMAN Small ubiquitin-related modifier 1 (Gene Name=SUMO1)

[Back to BioLiP]