Structure of PDB 6jvy Chain A Binding Site BS01

Receptor Information
>6jvy Chain A (length=86) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QKDTTFTKIFVGGLPYHTTDASLRKYFEGFGDIEEAVVITDRQTGKSRGY
GFVTMADRAAAERACKDPNPIIDGRKANVNLAYLGA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6jvy Structural basis for mRNA recognition by human RBM38.
Resolution2.003 Å
Binding residue
(original residue number in PDB)		K35 F37 G39 G40 L41 P42 Y43 E62 V64 Y77 F79 R102 N105 A109 G112 A113
Binding residue
(residue number reindexed from 1)		K8 F10 G12 G13 L14 P15 Y16 E35 V37 Y50 F52 R75 N78 A82 G85 A86
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:6jvy, PDBe:6jvy, PDBj:6jvy
PDBsum6jvy
PubMed31860021
UniProtQ9H0Z9|RBM38_HUMAN RNA-binding protein 38 (Gene Name=RBM38)

[Back to BioLiP]