Structure of PDB 6jtn Chain A Binding Site BS01

Receptor Information
>6jtn Chain A (length=273) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SHSMRYFYTAVSRPGRGEPRFIAVGYVDDTQFVQFDSDAASPRGEPRAPW
VEQEGPEYWDRETQKYKRQAQTDRVSLRNLRGYYNQSEAGSHTLQRMYGC
DLGPDGRLLRGYNQFAYDGKDYIALNEDLRSWTAADKAAQITQRKWEAAR
EAEQRRAYLEGTCVEWLRRYLENGKKTLQRAEHPKTHVTHHPVSDHEATL
RCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPS
GEEQRYTCHVQHEGLPEPLTLRW
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6jtn Immune-based mutation classification enables neoantigen prioritization and immune feature discovery in cancer immunotherapy.
Resolution1.9 Å
Binding residue
(original residue number in PDB)		Y7 E63 K66 R69 T73 S77 N80 Y84 Y99 Y123 T143 K146 W147 E152 R156 Y159 W167 Y171
Binding residue
(residue number reindexed from 1)		Y6 E62 K65 R68 T72 S76 N79 Y83 Y98 Y122 T142 K145 W146 E151 R155 Y158 W166 Y170
Enzymatic activity
Enzyme Commision number ?
External links