Structure of PDB 6jod Chain A Binding Site BS01

Receptor Information
>6jod Chain A (length=306) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
CSQKPSDKHLDAIPILYYIIFVIGFLVNIVVVTLFCCQKGPKKVSSIYIF
NLAVADLLLLATLPLWATYYSYRYDWLFGPVMCKVFGSFLTLNMFASIFF
ITCMSVDRYQSVIYPFLSQRRNPWQASYIVPLVWCMACLSSLPTFYFRDV
RTIEYLGVNACIMAFPPEKYAQWAAGIALMKNILGFIIPLIFIATCYFGI
RKHLLKTNSYGKNRITRDQVLKMAAAVVLAFIICWLPFHVLTFLDALAWM
GVINSCEVIAVIDLALPFAILLGFTNSCVNPFLYCFVGNRFQQKLRSVFR
VPITWL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6jod The Crystal Structure of Angiotensin II Type 2 Receptor with Endogenous Peptide Hormone.
Resolution3.2 Å
Binding residue
(original residue number in PDB)		W100 Y103 Y104 T125 M128 R182 I196 Y204 K215 F272 W283 L300 P301
Binding residue
(residue number reindexed from 1)		W66 Y69 Y70 T91 M94 R148 I162 Y170 K181 F238 W249 L266 P267
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0004930 G protein-coupled receptor activity
GO:0004945 angiotensin type II receptor activity
Biological Process
GO:0006954 inflammatory response
GO:0007186 G protein-coupled receptor signaling pathway
GO:0042981 regulation of apoptotic process
GO:0097746 blood vessel diameter maintenance
Cellular Component
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6jod, PDBe:6jod, PDBj:6jod
PDBsum6jod
PubMed31899086
UniProtP50052|AGTR2_HUMAN Type-2 angiotensin II receptor (Gene Name=AGTR2)

[Back to BioLiP]