Structure of PDB 6jnn Chain A Binding Site BS01

Receptor Information
>6jnn Chain A (length=89) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RNICPIKGCGKNFFSHKYLVQHQRVHSDDRPLKCPWKGCKMTFKWAWSRT
EHIRVHTGARPYVCAEPDCGQTFRFVSDFSRHKRKTGHS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6jnn DNA methylation repels targeting of Arabidopsis REF6.
Resolution2.6 Å
Binding residue
(original residue number in PDB)
F1277 F1278 Y1282 W1309 S1312 H1316 F1339 D1342
Binding residue
(residue number reindexed from 1)
F13 F14 Y18 W45 S48 H52 F75 D78
Binding affinityPDBbind-CN: Kd=65.7nM
Enzymatic activity
Enzyme Commision number 1.14.11.-
External links
PDB RCSB:6jnn, PDBe:6jnn, PDBj:6jnn
PDBsum6jnn
PubMed31048693
UniProtQ9STM3|REF6_ARATH Lysine-specific demethylase REF6 (Gene Name=REF6)

[Back to BioLiP]