Structure of PDB 6jmu Chain A Binding Site BS01

Receptor Information
>6jmu Chain A (length=127) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LDPGLPSTEDVILKTEQVTKNIQELLRAAQEFKHDSFVPCSEKIHLAVTE
MASLFPKRPALEPVRSSLRLLNASAYRLQSECRKTVPPEPGAPVDFQLLT
QQVIQCAYDIAKAAKQLVTITTREKKQ
Ligand information
>6jmu Chain C (length=21) Species: 10090 (Mus musculus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GSSATRELDELMASLSDFKMQ
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6jmu GIT/PIX Condensates Are Modular and Ideal for Distinct Compartmentalized Cell Signaling.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		T662 I665 L669 A672 Q673 Q744 I747 Q748 Y751 A754 K758 V761
Binding residue
(residue number reindexed from 1)		T19 I22 L26 A29 Q30 Q101 I104 Q105 Y108 A111 K115 V118
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005096 GTPase activator activity
Biological Process
GO:0007420 brain development
GO:0032012 regulation of ARF protein signal transduction

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6jmu, PDBe:6jmu, PDBj:6jmu
PDBsum6jmu
PubMed32780989
UniProtQ68FF6|GIT1_MOUSE ARF GTPase-activating protein GIT1 (Gene Name=Git1)

[Back to BioLiP]