Structure of PDB 6jjy Chain A Binding Site BS01

Receptor Information
>6jjy Chain A (length=128) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FELPLPEGWEEARDFDGKVYYIDHRNRTTSWIDPRDRYTKPLTFADCISD
ELPLGWEEAYDPQVGDYFIDHNTKTTQIEDPRVQWRREQEHMLKDYLVVA
QEALSAQKEIYQVKQQRLELAQQEYQQL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6jjy Decoding WW domain tandem-mediated target recognitions in tissue growth and cell polarity.
Resolution2.298 Å
Binding residue
(original residue number in PDB)
D17 Y23 I25 H27 R30 T32 W34 D64 V67 I72 H74 K77 T79 Q80 I81
Binding residue
(residue number reindexed from 1)
D14 Y20 I22 H24 R27 T29 W31 D61 V64 I69 H71 K74 T76 Q77 I78
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6jjy, PDBe:6jjy, PDBj:6jjy
PDBsum6jjy
PubMed31486770
UniProtQ5SXA9|KIBRA_MOUSE Protein KIBRA (Gene Name=Wwc1)

[Back to BioLiP]