Structure of PDB 6jjw Chain A Binding Site BS01

Receptor Information
>6jjw Chain A (length=89) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LPLPEGWEEARDFDGKVYYIDHRNRTTSWIDPRDRYTKPLTFADCISDEL
PLGWEEAYDPQVGDYFIDHNTKTTQIEDPRVQWRREQEH
Ligand information
>6jjw Chain U (length=20) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
IIVPSYRPTPDYETVMRQMK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6jjw Decoding WW domain tandem-mediated target recognitions in tissue growth and cell polarity.
Resolution2.4 Å
Binding residue
(original residue number in PDB)		D17 D19 Y23 I25 H27 R30 T32 S33 W34 D64 Q66 Y70 H74 K77 T79
Binding residue
(residue number reindexed from 1)		D12 D14 Y18 I20 H22 R25 T27 S28 W29 D59 Q61 Y65 H69 K72 T74
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6jjw, PDBe:6jjw, PDBj:6jjw
PDBsum6jjw
PubMed31486770
UniProtQ5SXA9|KIBRA_MOUSE Protein KIBRA (Gene Name=Wwc1)

[Back to BioLiP]