Structure of PDB 6jip Chain A Binding Site BS01

Receptor Information
>6jip Chain A (length=67) Species: 171101 (Streptococcus pneumoniae R6) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EFTFEIEEHLLTLSENEKGWTKEINRVSFNGAPAKFDIRAWSPDHTKMGK
GITLSNEEFQTMVDAFK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6jip Structural insight into the length-dependent binding of ssDNA by SP_0782 from Streptococcus pneumoniae, reveals a divergence in the DNA-binding interface of PC4-like proteins.
Resolution1.659 Å
Binding residue
(original residue number in PDB)		F12 W30 M58 G59
Binding residue
(residue number reindexed from 1)		F2 W20 M48 G49
Binding affinityPDBbind-CN: Kd=26.8uM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6jip, PDBe:6jip, PDBj:6jip
PDBsum6jip
PubMed31713614
UniProtQ8DQG2

[Back to BioLiP]