Structure of PDB 6jfa Chain A Binding Site BS01

Receptor Information
>6jfa Chain A (length=158) Species: 287 (Pseudomonas aeruginosa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IREILKMGDERLLRIAQPVPSELLGSEELQRLIDDMFETMHHVGGVGLAA
PQIGVDLQLVIFGPAVPPTILLNPRITPLDDEMEEGWEGCLSVPGLRGAV
SRHRRIRYQGLDPQGQPIDRSVEGFHARVVQHECDHLIGRLYPSRITDFS
KFGFTEVL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6jfa Met-Ala-Ser bound crystal structure of class I type b peptide deformylase from Pseudomonas aeruginosa
Resolution1.93 Å
Binding residue
(original residue number in PDB)		G48 V49 G50 E101 G102 R110 H145
Binding residue
(residue number reindexed from 1)		G45 V46 G47 E88 G89 R97 H132
Enzymatic activity
Catalytic site (original residue number in PDB) G50 Q55 C103 L104 H145 E146 H149
Catalytic site (residue number reindexed from 1) G47 Q52 C90 L91 H132 E133 H136
Enzyme Commision number 3.5.1.88: peptide deformylase.
Gene Ontology
Molecular Function
GO:0016787 hydrolase activity
GO:0042586 peptide deformylase activity
GO:0046872 metal ion binding
Biological Process
GO:0006412 translation
GO:0018206 peptidyl-methionine modification

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6jfa, PDBe:6jfa, PDBj:6jfa
PDBsum6jfa
PubMed
UniProtA0A071LDC0

[Back to BioLiP]