Structure of PDB 6jdg Chain A Binding Site BS01

Receptor Information
>6jdg Chain A (length=101) Species: 208964 (Pseudomonas aeruginosa PAO1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RGVNKVILVGNVGGDPETRYMPNGNAVTNITLATSEQERTEWHRVVFFGR
LAEIAGEYLRKGSQVYVEGSLRTRKWQGQDGQDRYTTEIVVDINGNMQLL
G
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6jdg Complexed crystal structure of SSB reveals a novel single-stranded DNA binding mode (SSB)3:1: Phe60 is not crucial for defining binding paths.
Resolution2.388 Å
Binding residue
(original residue number in PDB)		N13 G15 T33 A35 W54 G74 R86 W88 T98
Binding residue
(residue number reindexed from 1)		N11 G13 T31 A33 W42 G62 R74 W76 T86
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003697 single-stranded DNA binding
Biological Process
GO:0006260 DNA replication

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6jdg, PDBe:6jdg, PDBj:6jdg
PDBsum6jdg
PubMed31604524
UniProtP40947|SSB_PSEAE Single-stranded DNA-binding protein (Gene Name=ssb)

[Back to BioLiP]