Structure of PDB 6j9l Chain A Binding Site BS01

Receptor Information
>6j9l Chain A (length=112) Species: 487 (Neisseria meningitidis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KNNIFNKYPTIIHGEARGENDEFVVHTRYPRFLARKSFDDNFTGEMPAKP
VNGELGQIGEPRRLAYDSRLGLWLSDFIMLDNNKPKNMEDWLGQLKAACD
RIAADDLMLNED
Ligand information
>6j9l Chain E (length=27) Species: 264 (Francisella tularensis subsp. novicida) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SKDSYTLLMNNRTARRHQRRGIDRKQL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6j9l Diverse Mechanisms of CRISPR-Cas9 Inhibition by Type IIC Anti-CRISPR Proteins.
Resolution1.78 Å
Binding residue
(original residue number in PDB)		E18 N23 E25 F41 F45 D109 N113
Binding residue
(residue number reindexed from 1)		E15 N20 E22 F38 F42 D106 N110
Enzymatic activity
Enzyme Commision number ?
External links