Structure of PDB 6j9j Chain A Binding Site BS01

Receptor Information
>6j9j Chain A (length=247) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PSCVMDDFRDPQRWKECAKQGKMPCYFDLIEENVYLTERAMQCECTPLSK
DERAQGEIACGEDCLNRLLMIECSSRCPNGDYCSNRRFQRKQHADVEVIL
TEKKGWGLRAAKDLPSNTFVLEYCGEVLDHKEFKARVKEYARNKNIHYYF
MALKNDEIIDATQKGNCSRFMNHSCEPNCETQKWTVNGQLRVGFFTTKLV
PSGSELTFDYQFQRYGKEAQKCFCGSANCRGYLGGENRVSIRAAGGK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6j9j Histone H3.3 phosphorylation amplifies stimulation-induced transcription.
Resolution1.78 Å
Binding residue
(original residue number in PDB)		Y1579 F1589 Y1604 F1606 M1607 A1608 E1636 T1637 T1653 D1665 Y1666 Q1667 F1668 Q1669 R1670 Y1671 G1672 K1673 E1674 A1700
Binding residue
(residue number reindexed from 1)		Y123 F133 Y148 F150 M151 A152 E180 T181 T197 D209 Y210 Q211 F212 Q213 R214 Y215 G216 K217 E218 A244
Enzymatic activity
Enzyme Commision number 2.1.1.-
2.1.1.359: [histone H3]-lysine(36) N-trimethyltransferase.
Gene Ontology
Molecular Function
GO:0016279 protein-lysine N-methyltransferase activity
GO:0042054 histone methyltransferase activity
GO:0046975 histone H3K36 methyltransferase activity
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:6j9j, PDBe:6j9j, PDBj:6j9j
PDBsum6j9j
PubMed32699416
UniProtQ9BYW2|SETD2_HUMAN Histone-lysine N-methyltransferase SETD2 (Gene Name=SETD2)

[Back to BioLiP]