Structure of PDB 6j9c Chain A Binding Site BS01

Receptor Information
>6j9c Chain A (length=111) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DNKKLRVLCEKELKNSDVGSLGRIVLPKRDAEANLPKLSDKEGIVVQMRD
VFSMQSWSFKYKFWSNNKSRMYVLENTGEFVKQNGAEIGDFLTIYEDESK
NLYFAMNGNSG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6j9c Embryonic resetting of the parental vernalized state by two B3 domain transcription factors in Arabidopsis.
Resolution3.102 Å
Binding residue
(original residue number in PDB)		R185 K203 W226 S227 N228
Binding residue
(residue number reindexed from 1)		R23 K41 W64 S65 N66
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity

View graph for
Molecular Function
External links
PDB RCSB:6j9c, PDBe:6j9c, PDBj:6j9c
PDBsum6j9c
PubMed30962525
UniProtQ1PFR7|LEC2_ARATH B3 domain-containing transcription factor LEC2 (Gene Name=LEC2)

[Back to BioLiP]