Structure of PDB 6j68 Chain A Binding Site BS01

Receptor Information
>6j68 Chain A (length=123) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ELPLPEGWEEARDFDGKVYYIDHRNRTTSWIDPRDRYTKPLTFADCISDE
LPLGWEEAYDPQVGDYFIDHNTKTTQIEDPRVQWRREQEHMLKDYLVVAQ
EALSAQKEIYQVKQQRLELAQQE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6j68 Decoding WW domain tandem-mediated target recognitions in tissue growth and cell polarity.
Resolution2.495 Å
Binding residue
(original residue number in PDB)		Y23 I25 H27 R30 T32 S33 W34 D64 Y70 I72 H74 K77 T79 I81
Binding residue
(residue number reindexed from 1)		Y19 I21 H23 R26 T28 S29 W30 D60 Y66 I68 H70 K73 T75 I77
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6j68, PDBe:6j68, PDBj:6j68
PDBsum6j68
PubMed31486770
UniProtQ5SXA9|KIBRA_MOUSE Protein KIBRA (Gene Name=Wwc1)

[Back to BioLiP]