Structure of PDB 6j67 Chain A Binding Site BS01

Receptor Information

>6j67 Chain A (length=203) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

AGEARLEEAVNRWVLKFYFHEALRAFRGSRYGDFRQIRDIMQALLVRPLG
KEHTVSRLLRVMQCLSRIEEGENLDCSFDMEAELTPLESAINVLEMIKTE
FTLTEAVVESSRKLVKEAAVIICIKNKEFEKASKILKKHMSKDPTTQKLR
NDLLNIIREKNLAHPVIQNFSYETFQQKMLRFLESHLDDAEPYLLTMAKK
ALK

Ligand information

>6j67 Chain C (length=6) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

FFPLAP

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6j67 Cyclic Peptidic Mimetics of Apollo Peptides Targeting Telomeric Repeat Binding Factor 2 (TRF2) and Apollo Interaction.
Resolution	2.05 Å
Binding residue (original residue number in PDB)	R80 Q84 L87 K93 L101 R102 Q105 R109 S119 F120 M122
Binding residue (residue number reindexed from 1)	R38 Q42 L45 K51 L59 R60 Q63 R67 S77 F78 M80

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0042162	telomeric DNA binding
GO:0042803	protein homodimerization activity

	Biological Process
GO:0000723	telomere maintenance
GO:0031848	protection from non-homologous end joining at telomere

	Cellular Component
GO:0000781	chromosome, telomeric region
GO:0005634	nucleus

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6j67, PDBe:6j67, PDBj:6j67
PDBsum	6j67
PubMed	29795768
UniProt	Q15554\|TERF2_HUMAN Telomeric repeat-binding factor 2 (Gene Name=TERF2)

[Back to BioLiP]