Structure of PDB 6j56 Chain A Binding Site BS01

Receptor Information
>6j56 Chain A (length=115) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RQREIEMNRQQRFFRIPFIRKKKGWWYAHFDGPWIARQMELHPDKPPILL
VAGKDDMEMCELNLEETGLTRKRGAEILPRQFEEIWERCGGIQYLQNAIE
SRQARPTYATAMLQS
Ligand information
>6j56 Chain C (length=27) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GVTSEGKFDKFLEERAKAADRLPNLSS
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6j56 Structure of Myosin VI/Tom1 complex reveals a cargo recognition mode of Myosin VI for tethering.
Resolution1.798 Å
Binding residue
(original residue number in PDB)		I1173 F1175 W1193 Q1205 E1207 H1209 D1211 K1212 P1213 I1215 E1225 C1227 L1229 E1233 T1234
Binding residue
(residue number reindexed from 1)		I16 F18 W26 Q38 E40 H42 D44 K45 P46 I48 E58 C60 L62 E66 T67
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6j56, PDBe:6j56, PDBj:6j56
PDBsum6j56
PubMed31371777
UniProtQ9UM54|MYO6_HUMAN Unconventional myosin-VI (Gene Name=MYO6)

[Back to BioLiP]