Structure of PDB 6j2j Chain A Binding Site BS01

Receptor Information
>6j2j Chain A (length=277) Species: 9402 (Pteropus alecto) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GFHSLRYFYTAWSRPGSGEPRFVAVGYVDDTQFVRFDSDNASPRAEPRAP
WMDLVEQQDPQYWDRNTRNARDAAQTYRVGLDNVRGYYNQSEAGSHTIQR
MYGCDVGPHGRLLRGYDQLAYDGADYIALNEDLRSWTAADLAAQNTRRKW
EEAGYAERDRAYLEGECVEWLLKHLENGRETLLRADPPKTHITHHPISDR
EVTLRCWALGFYPEEITLTWQHDGEDQTQEMELVETRPDGNGAFQKWAAL
VVPSGEEQRYTCHVQHEGLPQPLTLRW
Ligand information
>6j2j Chain C (length=3) Species: 1335626 (Middle East respiratory syndrome-related coronavirus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
DFP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6j2j Peptide presentation by bat MHC class I provides new insight into the antiviral immunity of bats.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		Y7 Y9 A24 Y62 R65 N66 N69 G80 N83 Y87 T146 E166 W170
Binding residue
(residue number reindexed from 1)		Y7 Y9 A24 Y62 R65 N66 N69 G80 N83 Y87 T146 E166 W170
Enzymatic activity
Enzyme Commision number ?
External links