Structure of PDB 6j2h Chain A Binding Site BS01

Receptor Information
>6j2h Chain A (length=273) Species: 9402 (Pteropus alecto) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FHSLRYFYTAWSRPGSGEPRFVAVGYVDDTQFVRFDSDNASPRAEPRAPW
VEQQDPQYWDRNTRNARDAAQTYRVGLDNVRGYYNQSEAGSHTIQRMYGC
DVGPHGRLLRGYDQLAYDGADYIALNEDLRSWTAADLAAQNTRRKWEEAG
YAERDRAYLEGECVEWLLKHLENGRETLLRADPPKTHITHHPISDREVTL
RCWALGFYPEEITLTWQHDGEDQTQEMELVETRPDGNGAFQKWAALVVPS
GEEQRYTCHVQHEGLPQPLTLRW
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6j2h Peptide presentation by bat MHC class I provides new insight into the antiviral immunity of bats.
Resolution2.3 Å
Binding residue
(original residue number in PDB)		Y7 Y9 Y59 R62 N63 N66 A70 T73 Y74 G77 Y84 R97 Y99 T143 W147 Y152 D156 Y159 W167
Binding residue
(residue number reindexed from 1)		Y6 Y8 Y58 R61 N62 N65 A69 T72 Y73 G76 Y83 R96 Y98 T142 W146 Y151 D155 Y158 W166
Enzymatic activity
Enzyme Commision number ?
External links