Structure of PDB 6j1v Chain A Binding Site BS01

Receptor Information
>6j1v Chain A (length=274) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHSMRYFSTSVSRPGSGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAP
WIEQEGPEYWDQETRNVKAHSQTDRENLGTLRGYYNQSEAGSHTIQIMYG
CDVGSDGRFLRGYEQHAYDGKDYIALNEDLRSWTAADMAAQITQRKWEAA
RRAEQLRAYLEGTCVEWLRRYLENGKETLQRTDPPKTHMTHHPISDHEAT
LRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVP
SGEEQRYTCHVQHEGLPKPLTLRW
Ligand information
>6j1v Chain C (length=9) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
AIFQSSMTK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6j1v Divergent Peptide Presentations of HLA-A*30 Alleles Revealed by Structures With Pathogen Peptides.
Resolution2.0 Å
Binding residue
(original residue number in PDB)
Y7 E63 N66 V67 H70 T73 N77 Y84 Y99 H116 T143 K146 W147 A150 R152 Q155 L156 Y159 W167 Y171
Binding residue
(residue number reindexed from 1)
Y7 E63 N66 V67 H70 T73 N77 Y84 Y99 H116 T143 K146 W147 A150 R152 Q155 L156 Y159 W167 Y171
Enzymatic activity
Enzyme Commision number ?
External links