Structure of PDB 6iui Chain A Binding Site BS01

Receptor Information
>6iui Chain A (length=119) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GLPSTEDVILKTEQVTKNIQELLRAAQEFKHDSFVPCSEKIHLAVTEMAS
LFPKRPALEPVRSSLRLLNASAYRLQSECRKTVPPEPVDFQLLTQQVIQC
AYDIAKAAKQLVTITTREK
Ligand information
>6iui Chain D (length=21) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SATRELDELMASLSDFKFMAQ
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6iui Structural basis of the target-binding mode of the G protein-coupled receptor kinase-interacting protein in the regulation of focal adhesion dynamics.
Resolution2.6 Å
Binding residue
(original residue number in PDB)		I655 T662 I665 L669 Q673 Q744 I747 Q748 A750 Y751 A754 K755 K758
Binding residue
(residue number reindexed from 1)		I9 T16 I19 L23 Q27 Q95 I98 Q99 A101 Y102 A105 K106 K109
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005096 GTPase activator activity
Biological Process
GO:0007420 brain development
GO:0032012 regulation of ARF protein signal transduction

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6iui, PDBe:6iui, PDBj:6iui
PDBsum6iui
PubMed30737283
UniProtQ9Z272|GIT1_RAT ARF GTPase-activating protein GIT1 (Gene Name=Git1)

[Back to BioLiP]