Structure of PDB 6irl Chain A Binding Site BS01

Receptor Information
>6irl Chain A (length=272) Species: 9031 (Gallus gallus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EFELHTLRYISTAMTDPGPGQPWYVDVGYVDGELFTHYNSTARRAVPRTE
WIAANTDQQYWDSETQTSQRTEQIDRDGLGTLQRRYNQTGGSHTVQLMYG
CDILEDGTIRGYSQDAYDGRDFIAFDKDTMTFTAAVPEAVPTKRKWEEGD
YAEGLKQYLEETCVEWLRRYVEYGKAELGRRERPEVRVWGKEADGILTLS
CRAHGFYPRPIAVSWLKDGAVQGQDAQSGGIVPNGDGTYHTWVTIDAQPG
DGDKYQCRVEHASLPQPGLYSW
Ligand information
>6irl Chain C (length=8) Species: 196434 (Influenza A virus (A/Chicken/Hong Kong/715.5/01 (H5N1))) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
RREVHTYY
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6irl Structures of the MHC-I molecule BF2*1501 disclose the preferred presentation of an H5N1 virus-derived epitope.
Resolution2.1 Å
Binding residue
(original residue number in PDB)
Y10 D27 T37 H38 Y61 S64 E65 T68 S69 I75 V96 L98 Y100 S114 D116 T143 K146 W147 Y152 Y159 W167 Y171
Binding residue
(residue number reindexed from 1)
Y9 D26 T36 H37 Y60 S63 E64 T67 S68 I74 V95 L97 Y99 S113 D115 T142 K145 W146 Y151 Y158 W166 Y170
Enzymatic activity
Enzyme Commision number ?
External links