Structure of PDB 6ir8 Chain A Binding Site BS01

Receptor Information
>6ir8 Chain A (length=69) Species: 39947 (Oryza sativa Japonica Group) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NSVVVKNLDDGQAWRKYGQKEIQNSKHPKAYFRCTHKYDQLCTAQRQVQR
CDDDPASYRVTYIGEHTCR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ir8 Structural basis of dimerization and dual W-box DNA recognition by rice WRKY domain.
Resolution2.3 Å
Binding residue
(original residue number in PDB)		R124 K125 Y126 G127 Q128
Binding residue
(residue number reindexed from 1)		R15 K16 Y17 G18 Q19
Binding affinityPDBbind-CN: Kd=4.6uM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6ir8, PDBe:6ir8, PDBj:6ir8
PDBsum6ir8
PubMed30783673
UniProtB9FNW2

[Back to BioLiP]