Structure of PDB 6iqj Chain A Binding Site BS01

Receptor Information
>6iqj Chain A (length=131) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MSWQSYVDDHLMCEVEGNHLTHAAIFGQDGSVWAQSSAFPQLKPAEIAGI
NKDFEEAGHLAPTGLFLGGEKYMVVQGEAGAVIRGKKGPGGVTIKKTTQA
LVFGIYDEPMTGGQCNLVVERLGDYLIESGL
Ligand information
>6iqj Chain C (length=12) Species: 3702 (Arabidopsis thaliana) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
VPPPPPPPPPLP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6iqj Structural and computational examination of theArabidopsisprofilin-Poly-P complex reveals mechanistic details in profilin-regulated actin assembly.
Resolution1.922 Å
Binding residue
(original residue number in PDB)		M1 W3 Y6 H10 W33 Y125 S129 L131
Binding residue
(residue number reindexed from 1)		M1 W3 Y6 H10 W33 Y125 S129 L131
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003779 actin binding
GO:0005515 protein binding
Biological Process
GO:0006952 defense response
GO:0008154 actin polymerization or depolymerization
GO:0010229 inflorescence development
GO:0048366 leaf development
GO:0048527 lateral root development
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005783 endoplasmic reticulum
GO:0005829 cytosol
GO:0005856 cytoskeleton
GO:0005886 plasma membrane
GO:0009507 chloroplast

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6iqj, PDBe:6iqj, PDBj:6iqj
PDBsum6iqj
PubMed31653702
UniProtQ42418|PRF2_ARATH Profilin-2 (Gene Name=PRF2)

[Back to BioLiP]