Structure of PDB 6ilg Chain A Binding Site BS01

Receptor Information
>6ilg Chain A (length=279) Species: 9402 (Pteropus alecto) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GFHSLRYFYTAWSRPGSGEPRFVAVGYVDDTQFVRFDSDNASPRAEPRAP
WMDLVEQQDPQYWDRNTRNARDAAQTYRVGLDNVRGYYNQSEAGSHTIQR
MYGCDVGPHGRLLRGYDQLAYDGADYIALNEDLRSWTAADLAAQNTRRKW
EEAGYAERDRAYLEGECVEWLLKHLENGRETLLRADPPKTHITHHPISDR
EVTLRCWALGFYPEEITLTWQHDGEDQTQEMELVETRPDGNGAFQKWAAL
VVPSGEEQRYTCHVQHEGLPQPLTLRWEP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ilg Structure and Peptidome of the Bat MHC Class I Molecule Reveal a Novel Mechanism Leading to High-Affinity Peptide Binding.
Resolution2.6 Å
Binding residue
(original residue number in PDB)		Y7 Y9 Y62 R65 N66 N69 T76 Y77 N83 V84 Y87 R100 Y102 Y126 T146 K149 W150 Y155 Y162 W170
Binding residue
(residue number reindexed from 1)		Y7 Y9 Y62 R65 N66 N69 T76 Y77 N83 V84 Y87 R100 Y102 Y126 T146 K149 W150 Y155 Y162 W170
Enzymatic activity
Enzyme Commision number ?
External links