Structure of PDB 6iis Chain A Binding Site BS01

Receptor Information
>6iis Chain A (length=99) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MARPRPREYKAGDLVFAKMKGYPHWPARIDELPEGAVKPPANKYPIFFFG
THETAFLGPKDLFPYKEYKDKFGKSNKRKGFNEGLWEIENNPGVKFTGY
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6iis Complex structure of the HRP3 PWWP domain with both a 16-bp TA-rich DNA and an H3K36me3-containing histone peptide
Resolution2.358 Å
Binding residue
(original residue number in PDB)
K18 K20 G21 P23 N76 K77
Binding residue
(residue number reindexed from 1)
K18 K20 G21 P23 N76 K77
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6iis, PDBe:6iis, PDBj:6iis
PDBsum6iis
PubMed
UniProtQ9Y3E1|HDGR3_HUMAN Hepatoma-derived growth factor-related protein 3 (Gene Name=HDGFL3)

[Back to BioLiP]