Structure of PDB 6iex Chain A Binding Site BS01

Receptor Information
>6iex Chain A (length=274) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHSMRYFHTAMSRPGRGEPRFITVGYVDDTLFVRFDSDATSPRKEPRAP
WIEQEGPEYWDRETQISKTNTQTYRESLRNLRGYYNQSEAGSHTLQRMYG
CDVGPDGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTAAQISQRKLEAA
RVAEQLRAYLEGECVEWLRRYLENGKDKLERADPPKTHVTHHPISDHEAT
LRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVP
SGEEQRYTCHVQHEGLPKPLTLRW
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6iex Salt bridge-forming residues positioned over viral peptides presented by MHC class I impacts T-cell recognition in a binding-dependent manner.
Resolution2.314 Å
Binding residue
(original residue number in PDB)		Y7 H9 R62 E63 I66 T69 N70 T73 E76 S77 N80 Y84 Y99 Y116 L147 Q155 Y159 W167 Y171
Binding residue
(residue number reindexed from 1)		Y7 H9 R62 E63 I66 T69 N70 T73 E76 S77 N80 Y84 Y99 Y116 L147 Q155 Y159 W167 Y171
Enzymatic activity
Enzyme Commision number ?
External links