Structure of PDB 6ido Chain A Binding Site BS01

Receptor Information
>6ido Chain A (length=86) Species: 83333,272620 [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KQSIVKWLFELNAKQREVLARRFGLLGYEAATLEDVGREIGLTRERVRQI
QVEGLRRLREILQGQGLNIEALTQLTPEEKLLRAIF
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ido Structural basis for -35 element recognition by sigma4chimera proteins and their interactions with PmrA response regulator.
Resolution3.748 Å
Binding residue
(original residue number in PDB)		R37 L48 R59 E60 R63
Binding residue
(residue number reindexed from 1)		R22 L33 R44 E45 R48
Binding affinityPDBbind-CN: Kd=1.3uM
Enzymatic activity
Enzyme Commision number ?
2.7.7.6: DNA-directed RNA polymerase.
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006352 DNA-templated transcription initiation
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6ido, PDBe:6ido, PDBj:6ido
PDBsum6ido
PubMed31293000
UniProtA6TGP0;
P13445|RPOS_ECOLI RNA polymerase sigma factor RpoS (Gene Name=rpoS)

[Back to BioLiP]