Structure of PDB 6i5p Chain A Binding Site BS01

Receptor Information
>6i5p Chain A (length=136) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VVKFSYMWTINNFSFCREKMGEVIKSSTFSSGANDKLKWCLRVNPKGLDE
ESKDYLSLYLLLVSCPKSEVRAKFKFSILNAKGEETKAMESQRAYRFVQG
KDWGFKKFIRRDFLLDEANGLLPDDKLTLFCEVSVV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6i5p Structural Insights into BET Client Recognition of Endometrial and Prostate Cancer-Associated SPOP Mutants.
Resolution1.81 Å
Binding residue
(original residue number in PDB)
Y87 K129 D130 W131 G132 F133 K134
Binding residue
(residue number reindexed from 1)
Y59 K101 D102 W103 G104 F105 K106
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6i5p, PDBe:6i5p, PDBj:6i5p
PDBsum6i5p
PubMed31026449
UniProtO43791|SPOP_HUMAN Speckle-type POZ protein (Gene Name=SPOP)

[Back to BioLiP]