Structure of PDB 6i5n Chain A Binding Site BS01

Receptor Information
>6i5n Chain A (length=160) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SMQAARLAKALRELGQTGWYWGSMTVNEAKEKLKEAPEGTFLIRDSSHSD
YLLTISVKTSAGPTNLRIEYQDGKFRLDSIICVKSALAAFDSVVHLIDYY
VQMCKDKGTVHLYLTKPLYTSAPSLQHLCRLTINKCTGAIWGLPLPTRLK
DYLEEYKFQV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6i5n Structural insights into substrate recognition by the SOCS2 E3 ubiquitin ligase.
Resolution1.98 Å
Binding residue
(original residue number in PDB)		I109 Y128 M132 X133 D135 T147 V148 H149 L150
Binding residue
(residue number reindexed from 1)		I80 Y99 M103 X104 D106 T109 V110 H111 L112
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0035556 intracellular signal transduction

View graph for
Biological Process
External links
PDB RCSB:6i5n, PDBe:6i5n, PDBj:6i5n
PDBsum6i5n
PubMed31182716
UniProtO14508|SOCS2_HUMAN Suppressor of cytokine signaling 2 (Gene Name=SOCS2)

[Back to BioLiP]