Structure of PDB 6i5j Chain A Binding Site BS01

Receptor Information
>6i5j Chain A (length=168) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SMQAARLAKALRELGQTGWYWGSMTVNEAKEKLKEAPEGTFLIRDSSHSD
YLLTISVKTSAGPTNLRIEYQDGKFRLDSIICVKSKLKQFDSVVHLIDYY
VQMCKDKRGPEAPRNGTVHLYLTKPLYTSAPSLQHLCRLTINKCTGAIWG
LPLPTRLKDYLEEYKFQV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6i5j Structural insights into substrate recognition by the SOCS2 E3 ubiquitin ligase.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		R73 S75 S76 A90 G91 P92 T93 N94 L95 R96 D107 S108 I109 I110
Binding residue
(residue number reindexed from 1)		R44 S46 S47 A61 G62 P63 T64 N65 L66 R67 D78 S79 I80 I81
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0035556 intracellular signal transduction

View graph for
Biological Process
External links
PDB RCSB:6i5j, PDBe:6i5j, PDBj:6i5j
PDBsum6i5j
PubMed31182716
UniProtO14508|SOCS2_HUMAN Suppressor of cytokine signaling 2 (Gene Name=SOCS2)

[Back to BioLiP]