Structure of PDB 6i4x Chain A Binding Site BS01

Receptor Information
>6i4x Chain A (length=158) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SMQAARLAKALRELGQTGWYWGSMTVNEAKEKLKEAPEGTFLIRDSSHSD
YLLTISVKTSAGPTNLRIEYQDGKFRLDSIICVKSALAAFDSVVHLIDYY
VQMCKDKVHLYLTKPLYTSAPSLQHLCRLTINKCTGAIWGLPLPTRLKDY
LEEYKFQV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6i4x Structural insights into substrate recognition by the SOCS2 E3 ubiquitin ligase.
Resolution2.69 Å
Binding residue
(original residue number in PDB)		R73 S75 S76 T83 T93 N94 L95 R96 D107 S108 I109
Binding residue
(residue number reindexed from 1)		R44 S46 S47 T54 T64 N65 L66 R67 D78 S79 I80
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0035556 intracellular signal transduction

View graph for
Biological Process
External links
PDB RCSB:6i4x, PDBe:6i4x, PDBj:6i4x
PDBsum6i4x
PubMed31182716
UniProtO14508|SOCS2_HUMAN Suppressor of cytokine signaling 2 (Gene Name=SOCS2)

[Back to BioLiP]