Structure of PDB 6i41 Chain A Binding Site BS01

Receptor Information
>6i41 Chain A (length=139) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SGKVVKFSYMWTINNFSFCREGEVIKSSTFSSGANDKLKWCLRVNPKGLD
EESKDYLSLYLLLVSCPKSEVRAKFKFSILNAKGEETKAMESQRAYRFVQ
GKDWGFKKFIRRDFLLDEANGLLPDDKLTLFCEVSVVQD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6i41 Structural Insights into BET Client Recognition of Endometrial and Prostate Cancer-Associated SPOP Mutants.
Resolution1.9 Å
Binding residue
(original residue number in PDB)
Y87 Y123 K129 D130 W131 G132 F133 K134
Binding residue
(residue number reindexed from 1)
Y60 Y96 K102 D103 W104 G105 F106 K107
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6i41, PDBe:6i41, PDBj:6i41
PDBsum6i41
PubMed31026449
UniProtO43791|SPOP_HUMAN Speckle-type POZ protein (Gene Name=SPOP)

[Back to BioLiP]