Structure of PDB 6i2g Chain A Binding Site BS01

Receptor Information
>6i2g Chain A (length=121) Species: 30538 (Vicugna pacos) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VQLQESGGGLVQPGGSLRLSCTASGVTISALNAMAMGWYRQAPGERRVMV
AAVSERGNAMYRESVQGRFTVTRDFTNKMVSLQMDNLKPEDTAVYYCHVL
EDRVDSFHDYWGQGTQVTVSS
Ligand information
>6i2g Chain B (length=15) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
PSRLEEELRRRLTEP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6i2g The ALFA-tag is a highly versatile tool for nanobody-based bioscience applications.
Resolution1.5 Å
Binding residue
(original residue number in PDB)		Y42 M52 V53 S57 E58 R59 N61 M63 R65 L103 D105 V107 F110 D112
Binding residue
(residue number reindexed from 1)		Y39 M49 V50 S54 E55 R56 N58 M60 R62 L100 D102 V104 F107 D109
External links