Structure of PDB 6hv2 Chain A Binding Site BS01

Receptor Information

>6hv2 Chain A (length=166) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

EYNVRTLKWSKMNLTYRIVNYTPDMTHSEVEKAFKKAFKVWSDVTPLNFT
RLHDGIADIMISFGIKEHGDFYPFDGPSGLLAHAFPPGPNYGGDAHFDDD
ETWTSSSKGYNLFLVAAHEFGHSLGLDHSKDPGALMFPIYTYTGKSHFML
PDDDVQGIQSLYGPGD

Ligand information

>6hv2 Chain B (length=5) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

IMISF

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6hv2 Drug Design Inspired by Nature: Crystallographic Detection of an Auto-Tailored Protease Inhibitor Template.
Resolution	1.709 Å
Binding residue (original residue number in PDB)	S182 G183 L184 L185 A186 Y214 H222 E223 H226 H232 P242 I243 Y244
Binding residue (residue number reindexed from 1)	S78 G79 L80 L81 A82 Y110 H118 E119 H122 H128 P138 I139 Y140

Enzymatic activity

Enzyme Commision number

3.4.24.-

Gene Ontology

	Molecular Function
GO:0004222	metalloendopeptidase activity
GO:0008237	metallopeptidase activity
GO:0008270	zinc ion binding

	Biological Process
GO:0006508	proteolysis

	Cellular Component
GO:0031012	extracellular matrix

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6hv2, PDBe:6hv2, PDBj:6hv2
PDBsum	6hv2
PubMed	30615822
UniProt	P45452\|MMP13_HUMAN Collagenase 3 (Gene Name=MMP13)

[Back to BioLiP]