Structure of PDB 6hon Chain A Binding Site BS01

Receptor Information
>6hon Chain A (length=271) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HMLEREKIYQWINELSSPETRENALLELSKKRESVPDLAPMLWHSFGTIA
ALLQEIVNIYPSINPPTLTAHQSNRVCNALALLQCVASHPETRSAFLAAH
IPLFLYPFLHTVSKTRPFEYLRLTSLGVIGALVKTDEQEVINFLLTTEII
PLCLRIMESGSELSKTVATFILQKILLDDTGLAYICQTYERFSHVAMILG
KMVLQLSKEPSARLLKHVVRCYLRLSDNPRAREALRQCLPDQLKDTTFAQ
VLKDDTTTKRWLAQLVKNLQE
Ligand information
>6hon Chain B (length=25) Species: 7227 (Drosophila melanogaster) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
DDLGFDPFVETQKGLAELMENEVVQ
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6hon A conserved CAF40-binding motif in metazoan NOT4 mediates association with the CCR4-NOT complex.
Resolution2.2 Å
Binding residue
(original residue number in PDB)		R46 A84 H85 S87 N88 C91 N92 Y134 L137 T138 L177 T180 V181 F184 R227 H231
Binding residue
(residue number reindexed from 1)		R32 A70 H71 S73 N74 C77 N78 Y120 L123 T124 L163 T166 V167 F170 R213 H217
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006402 mRNA catabolic process
Cellular Component
GO:0030014 CCR4-NOT complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6hon, PDBe:6hon, PDBj:6hon
PDBsum6hon
PubMed30692204
UniProtQ92600|CNOT9_HUMAN CCR4-NOT transcription complex subunit 9 (Gene Name=CNOT9)

[Back to BioLiP]